PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10019083m
Common NameCICLE_v10019083mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GRAS
Protein Properties Length: 707aa    MW: 78266.6 Da    PI: 5.855
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10019083mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS325.21.3e-993487052374
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                      +++++++Ae ++ g+  laq +Larl+++ sp  +p+qR+a+y++eAL+  l+          p+ + s +n + +++a+k fse+sPil+f++
  Ciclev10019083m 348 IDQIFKAAELIEMGNPVLAQGILARLNHQLSPVVKPFQRAAFYVKEALQLLLHM-----NMNTPSAAMSGYNIIFKISAYKSFSEISPILQFAN 436
                      67899**********************************************998.....4445777778889********************** PP

             GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledl 189
                      +t+Nqa+lea+eg++r+HiiDfdi++G+QW++L+q+L  R+egppsl+iT++ s++++++ el  t+e+L++fA+e+++pfe ++l  ++l   
  Ciclev10019083m 437 FTCNQALLEAFEGCNRIHIIDFDIGYGGQWASLMQELVFRSEGPPSLKITAFTSSSTHDEFELGFTQENLKHFASEINIPFELEILSLETL-IS 529
                      *************************************************************************************844433.33 PP

             GRAS 190 eleeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpresee 281
                        + L ++   ++++aVnl + +++ +  +++     + vL++vk+l+Pk+vv  ++ +d+ + +F++++++al+ ys l++sl++    + ++
  Ciclev10019083m 530 ASWPLPLQGleNDVTAVNLPIGVFSNY--PATF----PLVLRFVKQLQPKIVVSLDRSCDRPDFPFAHHMVHALQSYSGLLESLDSV-NVNLDA 616
                      45666555555**********998887..4444....55*********************************************654.346699 PP

             GRAS 282 rikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                       +k+Er+l+ + i+++v  ++++     e+l  Wr+ ++++GF p+++s++a++qa++l+++++++g++ve+++ slvl+W++++L+s++aWr
  Ciclev10019083m 617 LQKIERFLVYPCIEKIVLGRHRS----PERLPPWRSLFMQSGFAPLTFSNFAESQADCLVQRTPVRGFHVEKRQSSLVLCWQRKELISATAWR 705
                      9*****************99998....9****************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098544.625321685IPR005202Transcription factor GRAS
PfamPF035144.3E-97348705IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0048768Biological Processroot hair cell tip growth
GO:0051301Biological Processcell division
Sequence ? help Back to Top
Protein Sequence    Length: 707 aa     Download sequence    Send to blast
MRAMPLAFED FQGKGALDFS SSSSDSRQFH HQQHKEEQDW LLSNSNRGNK KANCCYVGSA  60
TTEPTSVLDN RRSPSPPTSS STLSSSLGGG GSSTTDTTGV AATNASSNPP SVDITNTEKC  120
GGLGMEDWES VLSGSPNQEQ SILRLIMGDT DDPSLGLNKI LHQDTEFNAG FGVVDQASLG  180
FETPFTSVSS NIDPDFVVNS ARLGSVSTQN HIFSMAAATN LSPPPSVFQP QPVEALDEKP  240
QIFRPQLIMN QNQVQYAQNP ALFLPLSYAQ MQEHQLLSPP PPKRLNLGPN QKVPLSDSGQ  300
QELYLRRQQQ QQLQMLQQRQ TMGVTATATK QKMVNDELAN QQLQQAVIDQ IFKAAELIEM  360
GNPVLAQGIL ARLNHQLSPV VKPFQRAAFY VKEALQLLLH MNMNTPSAAM SGYNIIFKIS  420
AYKSFSEISP ILQFANFTCN QALLEAFEGC NRIHIIDFDI GYGGQWASLM QELVFRSEGP  480
PSLKITAFTS SSTHDEFELG FTQENLKHFA SEINIPFELE ILSLETLISA SWPLPLQGLE  540
NDVTAVNLPI GVFSNYPATF PLVLRFVKQL QPKIVVSLDR SCDRPDFPFA HHMVHALQSY  600
SGLLESLDSV NVNLDALQKI ERFLVYPCIE KIVLGRHRSP ERLPPWRSLF MQSGFAPLTF  660
SNFAESQADC LVQRTPVRGF HVEKRQSSLV LCWQRKELIS ATAWRC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-2936270518375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ5059570.0GQ505957.1 Citrus trifoliata cultivar Zhi SCL6 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006490864.10.0PREDICTED: scarecrow-like protein 6
RefseqXP_006445316.10.0hypothetical protein CICLE_v10019083mg
TrEMBLA0A067H1870.0A0A067H187_CITSI; Uncharacterized protein
TrEMBLV4U8M80.0V4U8M8_9R
STRINGVIT_15s0048g00270.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85742739
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-159GRAS family protein